Lineage for d2bjrb2 (2bjr B:185-368)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825565Fold b.169: MFPT repeat-like [141738] (1 superfamily)
    consists of two similar pseudo barrel subdomains with structural similarity to a circularly permuted SAND domain (63764)
  4. 2825566Superfamily b.169.1: MFPT repeat-like [141739] (1 family) (S)
  5. 2825567Family b.169.1.1: MFPT repeat [141740] (1 protein)
    PfamB PB008194
  6. 2825568Protein Sperm motility protein MFP2 [141741] (2 species)
  7. 2825572Species Pig roundworm (Ascaris suum), isoform B [TaxId:6253] [141742] (1 PDB entry)
    Uniprot Q7YXJ9 185-368! Uniprot Q7YXJ9 6-184
    MFPTb
  8. 2825576Domain d2bjrb2: 2bjr B:185-368 [128631]
    automated match to d2bjra2
    complexed with so4, zn

Details for d2bjrb2

PDB Entry: 2bjr (more details), 1.8 Å

PDB Description: crystal structure of the nematode sperm cell motility protein mfp2b
PDB Compounds: (B:) mfp2b

SCOPe Domain Sequences for d2bjrb2:

Sequence, based on SEQRES records: (download)

>d2bjrb2 b.169.1.1 (B:185-368) Sperm motility protein MFP2 {Pig roundworm (Ascaris suum), isoform B [TaxId: 6253]}
kpivrvtlnewadfrcgdpwptvgtpvralgrsldtlpgenpdqyvalwyqsgepvmgri
wndggkiaacfgwggheyrqkigsiqilyelpeairgfdydwkpfpeaaqfgakewipvh
vdhhkgnispavlivdgkeilgkadirneratigyggtekvlvgpavhscmvlcrkakpg
ctid

Sequence, based on observed residues (ATOM records): (download)

>d2bjrb2 b.169.1.1 (B:185-368) Sperm motility protein MFP2 {Pig roundworm (Ascaris suum), isoform B [TaxId: 6253]}
kvrvtlnewadfrcgdpwptvgtpvralgrsldtlpgenpdqyvalwyqsgepvmgriwn
dggkiaacfgwggheyrqkigsiqilyelpeairgfdydwkpfpeaaqewipvhvdhhkg
nispavlivdgkeilgkadirneratigyggtekvlvgpavhscmvlcrkakpgctid

SCOPe Domain Coordinates for d2bjrb2:

Click to download the PDB-style file with coordinates for d2bjrb2.
(The format of our PDB-style files is described here.)

Timeline for d2bjrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bjrb1