SCOPe 2.04: Domain d2bjra2: 2bjr A:185-368

Lineage for d2bjra2 (2bjr A:185-368)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.169: MFPT repeat-like [141738] (1 superfamily)
   consists of two similar pseudo barrel subdomains with structural similarity to a circularly permuted SAND domain (63764)

4. Superfamily b.169.1: MFPT repeat-like [141739] (1 family)

5. Family b.169.1.1: MFPT repeat [141740] (1 protein)
   PfamB PB008194

6. Protein Sperm motility protein MFP2 [141741] (2 species)

7. Species Pig roundworm (Ascaris suum), isoform B [TaxId:6253] [141742] (1 PDB entry)
   Uniprot Q7YXJ9 185-368! Uniprot Q7YXJ9 6-184
   MFPTb

8. Domain d2bjra2: 2bjr A:185-368 [128629]
   complexed with so4, zn

Details for d2bjra2

PDB Entry: 2bjr, 1.8 Å

PDB Description: crystal structure of the nematode sperm cell motility protein mfp2b

PDB Compounds: (A:) mfp2b

SCOPe Domain Sequences for d2bjra2:

Sequence; same for both SEQRES and ATOM records:

>d2bjra2 b.169.1.1 (A:185-368) Sperm motility protein MFP2 {Pig roundworm (Ascaris suum), isoform B [TaxId: 6253]}
kpivrvtlnewadfrcgdpwptvgtpvralgrsldtlpgenpdqyvalwyqsgepvmgri
wndggkiaacfgwggheyrqkigsiqilyelpeairgfdydwkpfpeaaqfgakewipvh
vdhhkgnispavlivdgkeilgkadirneratigyggtekvlvgpavhscmvlcrkakpg
ctid

Timeline for d2bjra2:

• d2bjra2 first appeared in SCOP 1.73
  
• d2bjra2 appears in SCOPe 2.03
  
• d2bjra2 appears in SCOPe 2.05
  
• d2bjra2 appears in the current release, SCOPe 2.08