Lineage for d2bjra2 (2bjr A:185-368)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 814069Fold b.169: MFPT repeat-like [141738] (1 superfamily)
    consists of two similar pseudo barrel subdomains with structural similarity to a circularly permuted SAND domain ((63764))
    consists of two similar pseudo barrel subdomains with structural similarity to a circularly permuted SAND domain ((63764))
  4. 814070Superfamily b.169.1: MFPT repeat-like [141739] (1 family) (S)
  5. 814071Family b.169.1.1: MFPT repeat [141740] (1 protein)
    PfamB PB008194
  6. 814072Protein Sperm motility protein MFP2 [141741] (2 species)
  7. 814076Species Pig roundworm (Ascaris suum), isoform B [TaxId:6253] [141742] (1 PDB entry)
    Uniprot Q7YXJ9 185-368! Uniprot Q7YXJ9 6-184
    MFPTb
  8. 814078Domain d2bjra2: 2bjr A:185-368 [128629]
    complexed with so4, zn

Details for d2bjra2

PDB Entry: 2bjr (more details), 1.8 Å

PDB Description: crystal structure of the nematode sperm cell motility protein mfp2b
PDB Compounds: (A:) mfp2b

SCOP Domain Sequences for d2bjra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjra2 b.169.1.1 (A:185-368) Sperm motility protein MFP2 {Pig roundworm (Ascaris suum), isoform B [TaxId: 6253]}
kpivrvtlnewadfrcgdpwptvgtpvralgrsldtlpgenpdqyvalwyqsgepvmgri
wndggkiaacfgwggheyrqkigsiqilyelpeairgfdydwkpfpeaaqfgakewipvh
vdhhkgnispavlivdgkeilgkadirneratigyggtekvlvgpavhscmvlcrkakpg
ctid

SCOP Domain Coordinates for d2bjra2:

Click to download the PDB-style file with coordinates for d2bjra2.
(The format of our PDB-style files is described here.)

Timeline for d2bjra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bjra1