Lineage for d2bjqa1 (2bjq A:175-344)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 681085Fold b.169: MFPT repeat-like [141738] (1 superfamily)
    consists of two similar pseudo barrel subdomains with structural similarity to a circularly permuted SAND domain (scop_fa 63764)
  4. 681086Superfamily b.169.1: MFPT repeat-like [141739] (1 family) (S)
  5. 681087Family b.169.1.1: MFPT repeat [141740] (1 protein)
    PfamB 008194
  6. 681088Protein Sperm motility protein MFP2 [141741] (2 species)
  7. 681089Species Pig roundworm (Ascaris suum), isoform A [TaxId:6253] [141743] (1 PDB entry)
    MFPTa
  8. 681090Domain d2bjqa1: 2bjq A:175-344 [128626]

Details for d2bjqa1

PDB Entry: 2bjq (more details), 1.75 Å

PDB Description: crystal structure of the nematode sperm cell motility protein mfp2
PDB Compounds: (A:) mfp2a

SCOP Domain Sequences for d2bjqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjqa1 b.169.1.1 (A:175-344) Sperm motility protein MFP2 {Pig roundworm (Ascaris suum), isoform A [TaxId: 6253]}
gikiyddtwldlkyrdpfpaarnpiaaggrkvksddgtemfqyvalwyehgqpvfgrayp
dsadktlanfgwggqenagaeigsfqmlvvpdpdilgfeykwipykeakaggpfkplhvg
ectpcllkdangterlgnlhmgmekataglagkdsavsgpavgdflvlcr

SCOP Domain Coordinates for d2bjqa1:

Click to download the PDB-style file with coordinates for d2bjqa1.
(The format of our PDB-style files is described here.)

Timeline for d2bjqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bjqa2