Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species) VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101504] (8 PDB entries) |
Domain d2bjml_: 2bjm L: [128625] Other proteins in same PDB: d2bjmh_ automated match to d1ocwl_ complexed with anf |
PDB Entry: 2bjm (more details), 2.15 Å
SCOPe Domain Sequences for d2bjml_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bjml_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Norway rat (Rattus norvegicus) [TaxId: 10116]} qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvle
Timeline for d2bjml_: