SCOP 1.73: Domain d2bjml1: 2bjm L:1-109

Lineage for d2bjml1 (2bjm L:1-109)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Rat (Rattus norvegicus) [TaxId:10116] [101504] (8 PDB entries)

8. Domain d2bjml1: 2bjm L:1-109 [128625]
   Other proteins in same PDB: d2bjmh1
   automatically matched to d1oaql_
   complexed with anf

Details for d2bjml1

PDB Entry: 2bjm, 2.15 Å

PDB Description: SPE7:Anthrone Complex

PDB Compounds: (L:) ige spe7 light chain

SCOP Domain Sequences for d2bjml1:

Sequence; same for both SEQRES and ATOM records:

>d2bjml1 b.1.1.1 (L:1-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

Timeline for d2bjml1:

• d2bjml1 is new in SCOP 1.73
  
• d2bjml1 appears in SCOP 1.75
  
• d2bjml1 appears in the current release, SCOPe 2.08, called d2bjml_