SCOPe 2.08: Domain d2bjml_: 2bjm L:

Lineage for d2bjml_ (2bjm L:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)

8. Domain d2bjml_: 2bjm L: [128625]
   Other proteins in same PDB: d2bjmh_
   automated match to d1ocwl_
   complexed with anf

Details for d2bjml_

PDB Entry: 2bjm, 2.15 Å

PDB Description: SPE7:Anthrone Complex

PDB Compounds: (L:) ige spe7 light chain

SCOPe Domain Sequences for d2bjml_:

Sequence; same for both SEQRES and ATOM records:

>d2bjml_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvle

Timeline for d2bjml_:

• d2bjml_ first appeared in SCOP 1.73, called d2bjml1
  
• d2bjml_ appears in SCOPe 2.07