SCOP 1.75: Domain d2bjmh1: 2bjm H:1-120

Lineage for d2bjmh1 (2bjm H:1-120)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)

8. Domain d2bjmh1: 2bjm H:1-120 [128624]
   Other proteins in same PDB: d2bjml1
   automatically matched to d1oarh_
   complexed with anf

Details for d2bjmh1

PDB Entry: 2bjm, 2.15 Å

PDB Description: SPE7:Anthrone Complex

PDB Compounds: (H:) ige spe7 heavy chain

SCOP Domain Sequences for d2bjmh1:

Sequence; same for both SEQRES and ATOM records:

>d2bjmh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss

Timeline for d2bjmh1:

• d2bjmh1 first appeared in SCOP 1.73
  
• d2bjmh1 is called d2bjmh_ in SCOPe 2.01
  
• d2bjmh1 appears in the current release, SCOPe 2.08, called d2bjmh_