SCOPe 2.08: Domain d2bjmh_: 2bjm H:

Lineage for d2bjmh_ (2bjm H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)

8. Domain d2bjmh_: 2bjm H: [128624]
   Other proteins in same PDB: d2bjml_
   automated match to d1oarh_
   complexed with anf

Details for d2bjmh_

PDB Entry: 2bjm, 2.15 Å

PDB Description: SPE7:Anthrone Complex

PDB Compounds: (H:) ige spe7 heavy chain

SCOPe Domain Sequences for d2bjmh_:

Sequence; same for both SEQRES and ATOM records:

>d2bjmh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss

Timeline for d2bjmh_:

• d2bjmh_ first appeared in SCOP 1.73, called d2bjmh1
  
• d2bjmh_ appears in SCOPe 2.07