SCOPe 2.08: Domain d2bjjx2: 2bjj X:340-692

Lineage for d2bjjx2 (2bjj X:340-692)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries)

8. Domain d2bjjx2: 2bjj X:340-692 [128623]
   automated match to d1jnfa2
   complexed with co3, fe, nag

Details for d2bjjx2

PDB Entry: 2bjj, 2.4 Å

PDB Description: structure of recombinant human lactoferrin produced in the milk of transgenic cows

PDB Compounds: (X:) lactotransferrin

SCOPe Domain Sequences for d2bjjx2:

Sequence; same for both SEQRES and ATOM records:

>d2bjjx2 c.94.1.0 (X:340-692) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aarrarvvwcavgeqelrkcnqwsglsegsvtcssasttedcialvlkgeadamsldggy
vytagkcglvpvlaenyksqqssdpdpncvdrpvegylavavvrrsdtsltwnsvkgkks
chtavdrtagwnipmgllfnqtgsckfdeyfsqscapgsdprsnlcalcigdeqgenkcv
pnsneryygytgafrclaenagdvafvkdvtvlqntdgnnndawakdlkladfallcldg
krkpvtearschlamapnhavvsrmdkverlkqvllhqqakfgrngsdcpdkfclfqset
knllfndnteclarlhgkttyekylgpqyvagitnlkkcstsplleaceflrk

Timeline for d2bjjx2:

• d2bjjx2 first appeared in SCOP 1.73
  
• d2bjjx2 appears in SCOPe 2.07