Lineage for d2bjjx1 (2bjj X:3-335)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 711143Family c.94.1.2: Transferrin [53888] (3 proteins)
    further duplication: composed of two two-domain lobes
  6. 711144Protein Lactoferrin [53889] (6 species)
  7. 711209Species Human (Homo sapiens) [TaxId:9606] [53890] (22 PDB entries)
  8. 711229Domain d2bjjx1: 2bjj X:3-335 [128622]
    automatically matched to d1n76a1
    complexed with co3, fe, nag

Details for d2bjjx1

PDB Entry: 2bjj (more details), 2.4 Å

PDB Description: structure of recombinant human lactoferrin produced in the milk of transgenic cows
PDB Compounds: (X:) lactotransferrin

SCOP Domain Sequences for d2bjjx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjjx1 c.94.1.2 (X:3-335) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]}
rrrsvqwcavsqpeatkcfqwqrnmrrvrgppvscikrdspiqciqaiaenradavtldg
gfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglrr
tagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenkc
afssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvdk
fkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllfk
dsaigfsrvppridsglylgsgyftaiqnlrks

SCOP Domain Coordinates for d2bjjx1:

Click to download the PDB-style file with coordinates for d2bjjx1.
(The format of our PDB-style files is described here.)

Timeline for d2bjjx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bjjx2