Lineage for d2bjjx1 (2bjj X:1-339)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (147 species)
    not a true protein
  7. 2487651Species Human (Homo sapiens) [TaxId:9606] [193730] (31 PDB entries)
  8. 2487679Domain d2bjjx1: 2bjj X:1-339 [128622]
    automated match to d1jnfa1
    complexed with co3, fe, nag

Details for d2bjjx1

PDB Entry: 2bjj (more details), 2.4 Å

PDB Description: structure of recombinant human lactoferrin produced in the milk of transgenic cows
PDB Compounds: (X:) lactotransferrin

SCOPe Domain Sequences for d2bjjx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjjx1 c.94.1.0 (X:1-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grrrrsvqwcavsqpeatkcfqwqrnmrrvrgppvscikrdspiqciqaiaenradavtl
dggfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtgl
rrtagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgen
kcafssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpv
dkfkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdll
fkdsaigfsrvppridsglylgsgyftaiqnlrkseeev

SCOPe Domain Coordinates for d2bjjx1:

Click to download the PDB-style file with coordinates for d2bjjx1.
(The format of our PDB-style files is described here.)

Timeline for d2bjjx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bjjx2