Lineage for d2bj9a1 (2bj9 A:1-50)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998574Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1998575Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1998782Family a.43.1.0: automated matches [230594] (1 protein)
    not a true family
  6. 1998783Protein automated matches [230595] (4 species)
    not a true protein
  7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [255054] (2 PDB entries)
  8. 1998811Domain d2bj9a1: 2bj9 A:1-50 [128616]
    Other proteins in same PDB: d2bj9a2, d2bj9b2
    automated match to d2bj7a1
    complexed with ni, pg4, po4

Details for d2bj9a1

PDB Entry: 2bj9 (more details), 3 Å

PDB Description: nikr with bound nickel and phosphate
PDB Compounds: (A:) nickel responsive regulator

SCOPe Domain Sequences for d2bj9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bj9a1 a.43.1.0 (A:1-50) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg

SCOPe Domain Coordinates for d2bj9a1:

Click to download the PDB-style file with coordinates for d2bj9a1.
(The format of our PDB-style files is described here.)

Timeline for d2bj9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bj9a2