Class a: All alpha proteins [46456] (286 folds) |
Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
Family a.43.1.0: automated matches [230594] (1 protein) not a true family |
Protein automated matches [230595] (4 species) not a true protein |
Domain d2bj9a1: 2bj9 A:1-50 [128616] Other proteins in same PDB: d2bj9a2, d2bj9b2 automated match to d2bj7a1 complexed with ni, pg4, po4 |
PDB Entry: 2bj9 (more details), 3 Å
SCOPe Domain Sequences for d2bj9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bj9a1 a.43.1.0 (A:1-50) automated matches {Pyrococcus horikoshii [TaxId: 70601]} melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg
Timeline for d2bj9a1: