![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (8 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.3: CopG-like [100970] (3 proteins) similar to the phage repressor family |
![]() | Protein Nickel responsive regulator NikR, N-terminal domain [101205] (2 species) |
![]() | Species Archaeon Pyrococcus horikoshii [TaxId:53953] [140543] (5 PDB entries) |
![]() | Domain d2bj9a1: 2bj9 A:1-50 [128616] Other proteins in same PDB: d2bj9a2, d2bj9b2 automatically matched to 2BJ1 A:1-50 complexed with ni, pg4, po4 |
PDB Entry: 2bj9 (more details), 3 Å
SCOP Domain Sequences for d2bj9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bj9a1 a.43.1.3 (A:1-50) Nickel responsive regulator NikR, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg
Timeline for d2bj9a1: