Lineage for d2bj8a2 (2bj8 A:51-132)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863190Superfamily d.58.18: ACT-like [55021] (14 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 863230Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein)
  6. 863231Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. 863232Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143375] (5 PDB entries)
    Uniprot O58316 51-132
  8. 863235Domain d2bj8a2: 2bj8 A:51-132 [128613]
    Other proteins in same PDB: d2bj8a1, d2bj8b1
    automatically matched to 2BJ1 A:51-132
    complexed with cl, edo, epe, ni, pg4

Details for d2bj8a2

PDB Entry: 2bj8 (more details), 2.1 Å

PDB Description: nikr in closed conformation and nickel bound to high and low-affinity sites
PDB Compounds: (A:) nickel responsive regulator

SCOP Domain Sequences for d2bj8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bj8a2 d.58.18.4 (A:51-132) Nickel responsive regulator NikR, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki
kmiadkllslkgvkhgklvmts

SCOP Domain Coordinates for d2bj8a2:

Click to download the PDB-style file with coordinates for d2bj8a2.
(The format of our PDB-style files is described here.)

Timeline for d2bj8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bj8a1