SCOPe 2.04: Domain d2bj7a1: 2bj7 A:1-50

Lineage for d2bj7a1 (2bj7 A:1-50)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.3: CopG-like [100970] (4 proteins)
   similar to the phage repressor family

6. Protein Nickel responsive regulator NikR, N-terminal domain [101205] (2 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [140543] (4 PDB entries)
   Uniprot O58316 1-50

8. Domain d2bj7a1: 2bj7 A:1-50 [128608]
   Other proteins in same PDB: d2bj7a2, d2bj7b2
   automated match to d2bj1a1
   complexed with cl, edo, ni, pg4

Details for d2bj7a1

PDB Entry: 2bj7, 2.1 Å

PDB Description: nikr in closed conformation and nickel bound to high-affinity sites

PDB Compounds: (A:) nickel responsive regulator

SCOPe Domain Sequences for d2bj7a1:

Sequence; same for both SEQRES and ATOM records:

>d2bj7a1 a.43.1.3 (A:1-50) Nickel responsive regulator NikR, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg

Timeline for d2bj7a1:

• d2bj7a1 first appeared in SCOP 1.73
  
• d2bj7a1 appears in SCOPe 2.03
  
• d2bj7a1 appears in SCOPe 2.05
  
• d2bj7a1 appears in the current release, SCOPe 2.08