![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins) automatically mapped to Pfam PF08753 |
![]() | Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [143375] (4 PDB entries) Uniprot O58316 51-132 |
![]() | Domain d2bj3d2: 2bj3 D:51-134 [128607] Other proteins in same PDB: d2bj3a1, d2bj3b1, d2bj3c1, d2bj3d1 automated match to d2bj1a2 complexed with cl, mg |
PDB Entry: 2bj3 (more details), 2.2 Å
SCOPe Domain Sequences for d2bj3d2:
Sequence, based on SEQRES records: (download)
>d2bj3d2 d.58.18.4 (D:51-134) Nickel responsive regulator NikR, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki kmiadkllslkgvkhgklvmtstg
>d2bj3d2 d.58.18.4 (D:51-134) Nickel responsive regulator NikR, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} neevagtitivynhgdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakkikm iadkllslkgvkhgklvmtstg
Timeline for d2bj3d2: