SCOP 1.75: Domain d2bj3d1: 2bj3 D:2-50

Lineage for d2bj3d1 (2bj3 D:2-50)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.3: CopG-like [100970] (4 proteins)
   similar to the phage repressor family

6. Protein Nickel responsive regulator NikR, N-terminal domain [101205] (2 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [140543] (5 PDB entries)
   Uniprot O58316 1-50

8. Domain d2bj3d1: 2bj3 D:2-50 [128606]
   Other proteins in same PDB: d2bj3a2, d2bj3b2, d2bj3c2, d2bj3d2
   automatically matched to 2BJ1 A:1-50
   complexed with cl, mg

Details for d2bj3d1

PDB Entry: 2bj3, 2.2 Å

PDB Description: nikr-apo

PDB Compounds: (D:) nickel responsive regulator

SCOP Domain Sequences for d2bj3d1:

Sequence; same for both SEQRES and ATOM records:

>d2bj3d1 a.43.1.3 (D:2-50) Nickel responsive regulator NikR, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
elirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg

Timeline for d2bj3d1:

• d2bj3d1 first appeared in SCOP 1.73
  
• d2bj3d1 appears in SCOPe 2.01
  
• d2bj3d1 appears in the current release, SCOPe 2.08