| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
| Family a.43.1.3: CopG-like [100970] (4 proteins) similar to the phage repressor family |
| Protein Nickel responsive regulator NikR, N-terminal domain [101205] (2 species) |
| Species Pyrococcus horikoshii [TaxId:53953] [140543] (4 PDB entries) Uniprot O58316 1-50 |
| Domain d2bj3c1: 2bj3 C:1-50 [128604] Other proteins in same PDB: d2bj3a2, d2bj3b2, d2bj3c2, d2bj3d2 automated match to d2bj1a1 complexed with cl, mg |
PDB Entry: 2bj3 (more details), 2.2 Å
SCOPe Domain Sequences for d2bj3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bj3c1 a.43.1.3 (C:1-50) Nickel responsive regulator NikR, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg
Timeline for d2bj3c1: