Lineage for d2bj3c1 (2bj3 C:1-50)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769512Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 769513Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 769556Family a.43.1.3: CopG-like [100970] (4 proteins)
    similar to the phage repressor family
  6. 769557Protein Nickel responsive regulator NikR, N-terminal domain [101205] (2 species)
  7. 769558Species Archaeon Pyrococcus horikoshii [TaxId:53953] [140543] (5 PDB entries)
    Uniprot O58316 1-50
  8. 769565Domain d2bj3c1: 2bj3 C:1-50 [128604]
    Other proteins in same PDB: d2bj3a2, d2bj3b2, d2bj3c2, d2bj3d2
    automatically matched to 2BJ1 A:1-50
    complexed with cl, mg

Details for d2bj3c1

PDB Entry: 2bj3 (more details), 2.2 Å

PDB Description: nikr-apo
PDB Compounds: (C:) nickel responsive regulator

SCOP Domain Sequences for d2bj3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bj3c1 a.43.1.3 (C:1-50) Nickel responsive regulator NikR, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg

SCOP Domain Coordinates for d2bj3c1:

Click to download the PDB-style file with coordinates for d2bj3c1.
(The format of our PDB-style files is described here.)

Timeline for d2bj3c1: