| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (12 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
| Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein) |
| Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species) |
| Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143375] (5 PDB entries) |
| Domain d2bj3b2: 2bj3 B:51-132 [128603] Other proteins in same PDB: d2bj3a1, d2bj3b1, d2bj3c1, d2bj3d1 automatically matched to 2BJ1 A:51-132 complexed with cl, mg |
PDB Entry: 2bj3 (more details), 2.2 Å
SCOP Domain Sequences for d2bj3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bj3b2 d.58.18.4 (B:51-132) Nickel responsive regulator NikR, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki
kmiadkllslkgvkhgklvmts
Timeline for d2bj3b2: