Lineage for d2bj3b1 (2bj3 B:2-50)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641597Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 641598Superfamily a.43.1: Ribbon-helix-helix [47598] (8 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 641641Family a.43.1.3: CopG-like [100970] (3 proteins)
    similar to the phage repressor family
  6. 641642Protein Nickel responsive regulator NikR, N-terminal domain [101205] (2 species)
  7. 641643Species Archaeon Pyrococcus horikoshii [TaxId:53953] [140543] (5 PDB entries)
  8. 641649Domain d2bj3b1: 2bj3 B:2-50 [128602]
    Other proteins in same PDB: d2bj3a2, d2bj3b2, d2bj3c2, d2bj3d2
    automatically matched to 2BJ1 A:1-50
    complexed with cl, mg

Details for d2bj3b1

PDB Entry: 2bj3 (more details), 2.2 Å

PDB Description: nikr-apo
PDB Compounds: (B:) nickel responsive regulator

SCOP Domain Sequences for d2bj3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bj3b1 a.43.1.3 (B:2-50) Nickel responsive regulator NikR, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
elirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg

SCOP Domain Coordinates for d2bj3b1:

Click to download the PDB-style file with coordinates for d2bj3b1.
(The format of our PDB-style files is described here.)

Timeline for d2bj3b1: