Lineage for d2bj3a2 (2bj3 A:51-136)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954103Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins)
    automatically mapped to Pfam PF08753
  6. 2954104Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. 2954135Species Pyrococcus horikoshii [TaxId:53953] [143375] (4 PDB entries)
    Uniprot O58316 51-132
  8. 2954140Domain d2bj3a2: 2bj3 A:51-136 [128601]
    Other proteins in same PDB: d2bj3a1, d2bj3b1, d2bj3c1, d2bj3d1
    automated match to d2bj1a2
    complexed with cl, mg

Details for d2bj3a2

PDB Entry: 2bj3 (more details), 2.2 Å

PDB Description: nikr-apo
PDB Compounds: (A:) nickel responsive regulator

SCOPe Domain Sequences for d2bj3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bj3a2 d.58.18.4 (A:51-136) Nickel responsive regulator NikR, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki
kmiadkllslkgvkhgklvmtstgke

SCOPe Domain Coordinates for d2bj3a2:

Click to download the PDB-style file with coordinates for d2bj3a2.
(The format of our PDB-style files is described here.)

Timeline for d2bj3a2: