Lineage for d2bj3a1 (2bj3 A:1-50)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325749Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2325750Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2325792Family a.43.1.3: CopG-like [100970] (4 proteins)
    similar to the phage repressor family
  6. 2325793Protein Nickel responsive regulator NikR, N-terminal domain [101205] (2 species)
  7. 2325811Species Pyrococcus horikoshii [TaxId:53953] [140543] (4 PDB entries)
    Uniprot O58316 1-50
  8. 2325816Domain d2bj3a1: 2bj3 A:1-50 [128600]
    Other proteins in same PDB: d2bj3a2, d2bj3b2, d2bj3c2, d2bj3d2
    automated match to d2bj1a1
    complexed with cl, mg

Details for d2bj3a1

PDB Entry: 2bj3 (more details), 2.2 Å

PDB Description: nikr-apo
PDB Compounds: (A:) nickel responsive regulator

SCOPe Domain Sequences for d2bj3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bj3a1 a.43.1.3 (A:1-50) Nickel responsive regulator NikR, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg

SCOPe Domain Coordinates for d2bj3a1:

Click to download the PDB-style file with coordinates for d2bj3a1.
(The format of our PDB-style files is described here.)

Timeline for d2bj3a1: