SCOP 1.73: Domain d2bj1b2: 2bj1 B:51-132

Lineage for d2bj1b2 (2bj1 B:51-132)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (12 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein)

6. Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143375] (5 PDB entries)

8. Domain d2bj1b2: 2bj1 B:51-132 [128599]
   Other proteins in same PDB: d2bj1a1, d2bj1b1
   automatically matched to 2BJ1 A:51-132
   complexed with cl, ni

Details for d2bj1b2

PDB Entry: 2bj1, 3 Å

PDB Description: nikr in open conformation and nickel bound to high-affinity sites

PDB Compounds: (B:) nickel responsive regulator

SCOP Domain Sequences for d2bj1b2:

Sequence; same for both SEQRES and ATOM records:

>d2bj1b2 d.58.18.4 (B:51-132) Nickel responsive regulator NikR, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki
kmiadkllslkgvkhgklvmts

Timeline for d2bj1b2:

• d2bj1b2 is new in SCOP 1.73
  
• d2bj1b2 appears in SCOP 1.75
  
• d2bj1b2 appears in the current release, SCOPe 2.08