Lineage for d2bj1b2 (2bj1 B:51-133)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2520976Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2521020Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins)
    automatically mapped to Pfam PF08753
  6. 2521062Protein automated matches [254488] (1 species)
    not a true protein
  7. 2521063Species Pyrococcus horikoshii OT3 [TaxId:70601] [255055] (2 PDB entries)
  8. 2521066Domain d2bj1b2: 2bj1 B:51-133 [128599]
    Other proteins in same PDB: d2bj1a1, d2bj1a2, d2bj1b1
    automated match to d2bj9a2
    complexed with cl, ni

Details for d2bj1b2

PDB Entry: 2bj1 (more details), 3 Å

PDB Description: nikr in open conformation and nickel bound to high-affinity sites
PDB Compounds: (B:) nickel responsive regulator

SCOPe Domain Sequences for d2bj1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bj1b2 d.58.18.4 (B:51-133) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki
kmiadkllslkgvkhgklvmtst

SCOPe Domain Coordinates for d2bj1b2:

Click to download the PDB-style file with coordinates for d2bj1b2.
(The format of our PDB-style files is described here.)

Timeline for d2bj1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bj1b1