Lineage for d2bj1b1 (2bj1 B:1-50)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641597Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 641598Superfamily a.43.1: Ribbon-helix-helix [47598] (8 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 641641Family a.43.1.3: CopG-like [100970] (3 proteins)
    similar to the phage repressor family
  6. 641642Protein Nickel responsive regulator NikR, N-terminal domain [101205] (2 species)
  7. 641643Species Archaeon Pyrococcus horikoshii [TaxId:53953] [140543] (5 PDB entries)
  8. 641655Domain d2bj1b1: 2bj1 B:1-50 [128598]
    Other proteins in same PDB: d2bj1a2, d2bj1b2
    automatically matched to 2BJ1 A:1-50
    complexed with cl, ni

Details for d2bj1b1

PDB Entry: 2bj1 (more details), 3 Å

PDB Description: nikr in open conformation and nickel bound to high-affinity sites
PDB Compounds: (B:) nickel responsive regulator

SCOP Domain Sequences for d2bj1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bj1b1 a.43.1.3 (B:1-50) Nickel responsive regulator NikR, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg

SCOP Domain Coordinates for d2bj1b1:

Click to download the PDB-style file with coordinates for d2bj1b1.
(The format of our PDB-style files is described here.)

Timeline for d2bj1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bj1b2