Lineage for d2bj1b1 (2bj1 B:1-50)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712590Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2712591Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2712798Family a.43.1.0: automated matches [230594] (1 protein)
    not a true family
  6. 2712799Protein automated matches [230595] (4 species)
    not a true protein
  7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [255054] (2 PDB entries)
  8. 2712829Domain d2bj1b1: 2bj1 B:1-50 [128598]
    Other proteins in same PDB: d2bj1a1, d2bj1a2, d2bj1b2
    automated match to d2bj7a1
    complexed with cl, ni

Details for d2bj1b1

PDB Entry: 2bj1 (more details), 3 Å

PDB Description: nikr in open conformation and nickel bound to high-affinity sites
PDB Compounds: (B:) nickel responsive regulator

SCOPe Domain Sequences for d2bj1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bj1b1 a.43.1.0 (B:1-50) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg

SCOPe Domain Coordinates for d2bj1b1:

Click to download the PDB-style file with coordinates for d2bj1b1.
(The format of our PDB-style files is described here.)

Timeline for d2bj1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bj1b2