Lineage for d2bj1a2 (2bj1 A:51-132)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197025Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2197069Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins)
    automatically mapped to Pfam PF08753
  6. 2197070Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. 2197101Species Pyrococcus horikoshii [TaxId:53953] [143375] (4 PDB entries)
    Uniprot O58316 51-132
  8. 2197110Domain d2bj1a2: 2bj1 A:51-132 [128597]
    Other proteins in same PDB: d2bj1a1, d2bj1b1, d2bj1b2
    complexed with cl, ni

Details for d2bj1a2

PDB Entry: 2bj1 (more details), 3 Å

PDB Description: nikr in open conformation and nickel bound to high-affinity sites
PDB Compounds: (A:) nickel responsive regulator

SCOPe Domain Sequences for d2bj1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bj1a2 d.58.18.4 (A:51-132) Nickel responsive regulator NikR, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki
kmiadkllslkgvkhgklvmts

SCOPe Domain Coordinates for d2bj1a2:

Click to download the PDB-style file with coordinates for d2bj1a2.
(The format of our PDB-style files is described here.)

Timeline for d2bj1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bj1a1