SCOP 1.73: Domain d2bivb2: 2biv B:140-243

Lineage for d2bivb2 (2biv B:140-243)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families)

5. Family b.34.9.3: MBT repeat [89299] (4 proteins)
   Pfam PF02820
   contains extended 'arm', N-terminal to the common fold core

6. Protein Scml2 protein [89300] (1 species)
   duplication: contains tandem repeat of two MBT repeats

7. Species Human (Homo sapiens) [TaxId:9606] [89301] (2 PDB entries)

8. Domain d2bivb2: 2biv B:140-243 [128595]
   automatically matched to d1oi1a2
   complexed with iod, na

Details for d2bivb2

PDB Entry: 2biv, 1.7 Å

PDB Description: crystal structure of the wild-type mbt domains of human scml2

PDB Compounds: (B:) sex comb on midleg-like protein 2

SCOP Domain Sequences for d2bivb2:

Sequence; same for both SEQRES and ATOM records:

>d2bivb2 b.34.9.3 (B:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]}
swpmfllktlngsemasatlfkkeppkpplnnfkvgmkleaidkknpylicpatigdvkg
devhitfdgwsgafdywckydsrdifpagwcrltgdvlqppgts

Timeline for d2bivb2:

• d2bivb2 is new in SCOP 1.73
  
• d2bivb2 appears in SCOP 1.75
  
• d2bivb2 appears in the current release, SCOPe 2.08