Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
Protein automated matches [191144] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries) |
Domain d2bivb1: 2biv B:27-133 [128594] automated match to d1oz3a1 complexed with iod, na |
PDB Entry: 2biv (more details), 1.7 Å
SCOPe Domain Sequences for d2bivb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bivb1 b.34.9.0 (B:27-133) automated matches {Human (Homo sapiens) [TaxId: 9606]} svqrddfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvi gitgarlrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplg
Timeline for d2bivb1:
View in 3D Domains from other chains: (mouse over for more information) d2biva1, d2biva2, d2bivc1, d2bivc2 |