Lineage for d2biva1 (2biv A:33-135)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311123Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1311234Family b.34.9.3: MBT repeat [89299] (4 proteins)
    Pfam PF02820
    contains extended 'arm', N-terminal to the common fold core
  6. 1311265Protein Scml2 protein [89300] (1 species)
    duplication: contains tandem repeat of two MBT repeats
  7. 1311266Species Human (Homo sapiens) [TaxId:9606] [89301] (3 PDB entries)
  8. 1311269Domain d2biva1: 2biv A:33-135 [128592]
    Other proteins in same PDB: d2bivc1, d2bivc2
    automatically matched to d1oi1a1
    complexed with iod, na

Details for d2biva1

PDB Entry: 2biv (more details), 1.7 Å

PDB Description: crystal structure of the wild-type mbt domains of human scml2
PDB Compounds: (A:) sex comb on midleg-like protein 2

SCOPe Domain Sequences for d2biva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2biva1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]}
fhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigitgar
lrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplgyq

SCOPe Domain Coordinates for d2biva1:

Click to download the PDB-style file with coordinates for d2biva1.
(The format of our PDB-style files is described here.)

Timeline for d2biva1: