Lineage for d2bitx1 (2bit X:2-165)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674493Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 674494Superfamily b.62.1: Cyclophilin-like [50891] (3 families) (S)
  5. 674495Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 674664Protein Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F [141511] (1 species)
  7. 674665Species Human (Homo sapiens) [TaxId:9606] [141512] (2 PDB entries)
  8. 674666Domain d2bitx1: 2bit X:2-165 [128590]
    mutant

Details for d2bitx1

PDB Entry: 2bit (more details), 1.71 Å

PDB Description: crystal structure of human cyclophilin d at 1.7 a resolution
PDB Compounds: (X:) peptidyl-prolyl cis-trans isomerase

SCOP Domain Sequences for d2bitx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bitx1 b.62.1.1 (X:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]}
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

SCOP Domain Coordinates for d2bitx1:

Click to download the PDB-style file with coordinates for d2bitx1.
(The format of our PDB-style files is described here.)

Timeline for d2bitx1: