![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
![]() | Protein Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F [141511] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141512] (46 PDB entries) Uniprot P30405 44-207 |
![]() | Domain d2bitx1: 2bit X:2-165 [128590] |
PDB Entry: 2bit (more details), 1.71 Å
SCOPe Domain Sequences for d2bitx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bitx1 b.62.1.1 (X:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls
Timeline for d2bitx1: