Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) |
Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins) Pfam PF00534 |
Protein automated matches [190508] (1 species) not a true protein |
Species Pyrococcus abyssi [TaxId:29292] [187462] (2 PDB entries) |
Domain d2bisc_: 2bis C: [128589] Other proteins in same PDB: d2bisa1 automated match to d2bisa1 complexed with dio, glc, gol, udp |
PDB Entry: 2bis (more details), 2.8 Å
SCOPe Domain Sequences for d2bisc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bisc_ c.87.1.8 (C:) automated matches {Pyrococcus abyssi [TaxId: 29292]} gshmkvlllgfeflpvkvgglaealtaisealaslghevlvftpshgrfqgeeigkirvf geevqvkvsyeergnlriyriggglldsedvygpgwdglirkavtfgrasvlllndllre eplpdvvhfhdwhtvfagalikkyfkipavftihrlnksklpafyfheaglselapypdi dpehtggyiadivttvsrgylidewgffrnfegkityvfngidcsfwnesyltgsrderk ksllskfgmdegvtfmfigrfdrgqkgvdvllkaieilsskkefqemrfiiigkgdpele gwarsleekhgnvkvitemlsrefvrelygsvdfviipsyfepfglvaleamclgaipia savgglrdiitnetgilvkagdpgelanailkalelsrsdlskfrenckkramsfsweks aeryvkaytgsidrafdfil
Timeline for d2bisc_: