Lineage for d2bisb_ (2bis B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1007198Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 1007199Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (12 families) (S)
  5. 1007536Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins)
    Pfam PF00534
  6. 1007553Protein automated matches [190508] (1 species)
    not a true protein
  7. 1007554Species Pyrococcus abyssi [TaxId:29292] [187462] (2 PDB entries)
  8. 1007558Domain d2bisb_: 2bis B: [128588]
    Other proteins in same PDB: d2bisa1
    automated match to d2bisa1
    complexed with dio, glc, gol, udp

Details for d2bisb_

PDB Entry: 2bis (more details), 2.8 Å

PDB Description: structure of glycogen synthase from pyrococcus abyssi
PDB Compounds: (B:) glga glycogen synthase

SCOPe Domain Sequences for d2bisb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bisb_ c.87.1.8 (B:) automated matches {Pyrococcus abyssi [TaxId: 29292]}
gshmkvlllgfeflpvkvgglaealtaisealaslghevlvftpshgrfqgeeigkirvf
geevqvkvsyeergnlriyriggglldsedvygpgwdglirkavtfgrasvlllndllre
eplpdvvhfhdwhtvfagalikkyfkipavftihrlnksklpafyfheaglselapypdi
dpehtggyiadivttvsrgylidewgffrnfegkityvfngidcsfwnesyltgsrderk
ksllskfgmdegvtfmfigrfdrgqkgvdvllkaieilsskkefqemrfiiigkgdpele
gwarsleekhgnvkvitemlsrefvrelygsvdfviipsyfepfglvaleamclgaipia
savgglrdiitnetgilvkagdpgelanailkalelsrsdlskfrenckkramsfsweks
aeryvkaytgsidrafdfil

SCOPe Domain Coordinates for d2bisb_:

Click to download the PDB-style file with coordinates for d2bisb_.
(The format of our PDB-style files is described here.)

Timeline for d2bisb_: