Lineage for d2bisb2 (2bis B:1-437)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2910940Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins)
    Pfam PF00534
  6. 2910957Protein automated matches [190508] (1 species)
    not a true protein
  7. 2910958Species Pyrococcus abyssi [TaxId:29292] [187462] (2 PDB entries)
  8. 2910962Domain d2bisb2: 2bis B:1-437 [128588]
    Other proteins in same PDB: d2bisa1, d2bisb3, d2bisc3
    automated match to d2bisa1
    complexed with dio, glc, gol, udp

Details for d2bisb2

PDB Entry: 2bis (more details), 2.8 Å

PDB Description: structure of glycogen synthase from pyrococcus abyssi
PDB Compounds: (B:) glga glycogen synthase

SCOPe Domain Sequences for d2bisb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bisb2 c.87.1.8 (B:1-437) automated matches {Pyrococcus abyssi [TaxId: 29292]}
mkvlllgfeflpvkvgglaealtaisealaslghevlvftpshgrfqgeeigkirvfgee
vqvkvsyeergnlriyriggglldsedvygpgwdglirkavtfgrasvlllndllreepl
pdvvhfhdwhtvfagalikkyfkipavftihrlnksklpafyfheaglselapypdidpe
htggyiadivttvsrgylidewgffrnfegkityvfngidcsfwnesyltgsrderkksl
lskfgmdegvtfmfigrfdrgqkgvdvllkaieilsskkefqemrfiiigkgdpelegwa
rsleekhgnvkvitemlsrefvrelygsvdfviipsyfepfglvaleamclgaipiasav
gglrdiitnetgilvkagdpgelanailkalelsrsdlskfrenckkramsfsweksaer
yvkaytgsidrafdfil

SCOPe Domain Coordinates for d2bisb2:

Click to download the PDB-style file with coordinates for d2bisb2.
(The format of our PDB-style files is described here.)

Timeline for d2bisb2: