Lineage for d2bisa1 (2bis A:1-437)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2910940Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins)
    Pfam PF00534
  6. 2910944Protein Glycogen synthase 1, GlgA [110735] (2 species)
  7. 2910950Species Pyrococcus abyssi [TaxId:29292] [142768] (2 PDB entries)
    Uniprot Q9V2J8 1-437! Uniprot Q9V2J8 218-413
  8. 2910952Domain d2bisa1: 2bis A:1-437 [128587]
    Other proteins in same PDB: d2bisb2, d2bisb3, d2bisc2, d2bisc3
    complexed with dio, glc, gol, udp

Details for d2bisa1

PDB Entry: 2bis (more details), 2.8 Å

PDB Description: structure of glycogen synthase from pyrococcus abyssi
PDB Compounds: (A:) glga glycogen synthase

SCOPe Domain Sequences for d2bisa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]}
mkvlllgfeflpvkvgglaealtaisealaslghevlvftpshgrfqgeeigkirvfgee
vqvkvsyeergnlriyriggglldsedvygpgwdglirkavtfgrasvlllndllreepl
pdvvhfhdwhtvfagalikkyfkipavftihrlnksklpafyfheaglselapypdidpe
htggyiadivttvsrgylidewgffrnfegkityvfngidcsfwnesyltgsrderkksl
lskfgmdegvtfmfigrfdrgqkgvdvllkaieilsskkefqemrfiiigkgdpelegwa
rsleekhgnvkvitemlsrefvrelygsvdfviipsyfepfglvaleamclgaipiasav
gglrdiitnetgilvkagdpgelanailkalelsrsdlskfrenckkramsfsweksaer
yvkaytgsidrafdfil

SCOPe Domain Coordinates for d2bisa1:

Click to download the PDB-style file with coordinates for d2bisa1.
(The format of our PDB-style files is described here.)

Timeline for d2bisa1: