Lineage for d2biga_ (2big A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131870Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)
  7. 2131871Species Bacillus alcalophilus [TaxId:1445] [117697] (12 PDB entries)
    Uniprot Q9RME2
  8. 2131874Domain d2biga_: 2big A: [128585]
    automated match to d1w23a_
    complexed with cl, mg, peg, pge, plp

Details for d2biga_

PDB Entry: 2big (more details), 1.3 Å

PDB Description: radiation damage of the schiff base in phosphoserine aminotransferase (structure i)
PDB Compounds: (A:) phosphoserine aminotransferase

SCOPe Domain Sequences for d2biga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2biga_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]}
qvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrellq
ipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaast
kansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsrpl
kvnqfgmiyagaqknlgpsgvtvvivkkdllntkveqvptmlqyathiksdslyntpptf
siymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvtfn
lrneelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena

SCOPe Domain Coordinates for d2biga_:

Click to download the PDB-style file with coordinates for d2biga_.
(The format of our PDB-style files is described here.)

Timeline for d2biga_: