![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
![]() | Protein Phosphoserine aminotransferase, PSAT [53426] (3 species) |
![]() | Species Bacillus alcalophilus [TaxId:1445] [117697] (12 PDB entries) Uniprot Q9RME2 |
![]() | Domain d2biea1: 2bie A:3-360 [128583] complexed with cl, mg, peg, pge, plp |
PDB Entry: 2bie (more details), 1.3 Å
SCOPe Domain Sequences for d2biea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2biea1 c.67.1.4 (A:3-360) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} qvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrellq ipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaast kansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsrpl kvnqfgmiyagaqknlgpsgvtvvivkkdllntkveqvptmlqyathiksdslyntpptf siymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvtfn lrneelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena
Timeline for d2biea1: