Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families) |
Family d.157.1.8: Pce catalytic domain-like [143921] (1 protein) part of Pfam PF00753 |
Protein Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain [143922] (1 species) |
Species Streptococcus pneumoniae [TaxId:1313] [143923] (2 PDB entries) |
Domain d2biba2: 2bib A:1-308 [128582] Other proteins in same PDB: d2biba1 complexed with btb, ca, pc, zn |
PDB Entry: 2bib (more details), 1.92 Å
SCOP Domain Sequences for d2biba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2biba2 d.157.1.8 (A:1-308) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} qessgnkihfinvqeggsdaiilesnghfamvdtgedydfpdgsdsrypwregietsykh vltdrvfrrlkelsvqkldfilvththsdhignvdellstypvdrvylkkysdsritnse rlwdnlygydkvlqtatetgvsviqnitqgdahfqfgdmdiqlynyenetdssgelkkiw ddnsnslisvvkvngkkiylggdldnvhgaedkygpligkvdlmkfnhhhdtnksntkdf iknlspslivqtsdslpwkngvdseyvnwlkergierinaaskdydatvfdirkdgfvni stsykpip
Timeline for d2biba2: