SCOPe 2.08: Domain d2biba1: 2bib A:309-541

Lineage for d2biba1 (2bib A:309-541)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.109: beta-hairpin stack [69359] (1 superfamily)
   Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn

4. Superfamily b.109.1: Cell wall binding repeat [69360] (1 family)

5. Family b.109.1.1: Cell wall binding repeat [69361] (4 proteins)
   this is a repeat family; one repeat unit is 2bib A:415-315 found in domain

6. Protein Teichoic acid phosphorylcholine esterase Pce (LytD), C-terminal domain [141652] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141653] (1 PDB entry)
   Uniprot Q8DQ62 335-566

8. Domain d2biba1: 2bib A:309-541 [128581]
   Other proteins in same PDB: d2biba2
   complexed with btb, ca, pc, zn
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d2biba1

PDB Entry: 2bib, 1.92 Å

PDB Description: crystal structure of the complete modular teichioic acid phosphorylcholine esterase pce (cbpe) from streptococcus pneumoniae

PDB Compounds: (A:) teichoic acid phosphorylcholine esterase/ choline binding protein

SCOPe Domain Sequences for d2biba1:

Sequence; same for both SEQRES and ATOM records:

>d2biba1 b.109.1.1 (A:309-541) Teichoic acid phosphorylcholine esterase Pce (LytD), C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
sfqagwhksaygnwwyqapdstgeyavgwneiegewyyfnqtgillqnqwkkwnnhwfyl
tdsgasaknwkkidgiwyyfnkenqmeigwvqdkeqwyyldvdgsmktgwlqymgqwyyf
apsgemkmgwvkdketwyymdstgvmktgeievagqhyyledsgamkqgwhkkandwyfy
ktdgsravgwikdkdkwyflkengqllvngktpegytvdssgawlvdvsieks

Timeline for d2biba1:

• d2biba1 first appeared in SCOP 1.73
  
• d2biba1 appears in SCOPe 2.07