SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2bi5b_ (2bi5 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131870Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)
  7. 2131871Species Bacillus alcalophilus [TaxId:1445] [117697] (12 PDB entries)
    Uniprot Q9RME2
  8. 2131891Domain d2bi5b_: 2bi5 B: [128576]
    automated match to d1w23a_
    complexed with 1pe, cl, mg, peg, plp

Details for d2bi5b_

PDB Entry: 2bi5 (more details), 1.73 Å

PDB Description: radiation damage of the schiff base in phosphoserine aminotransferase (structure e)
PDB Compounds: (B:) phosphoserine aminotransferase

SCOPe Domain Sequences for d2bi5b_:

Sequence, based on SEQRES records: (download)

>d2bi5b_ c.67.1.4 (B:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]}
kqvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrell
qipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaas
tkansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsrp
lkvnqfgmiyagaqknlgpsgvtvvivkkdllntkveqvptmlqyathiksdslyntppt
fsiymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvtf
nlrneelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena

Sequence, based on observed residues (ATOM records): (download)

>d2bi5b_ c.67.1.4 (B:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]}
kqvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrell
qipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaas
tkansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsrp
lkvnqfgmiyagaqknlgpsgvtvvivkkdllveqvptmlqyathiksdslyntpptfsi
ymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvtfnlr
neelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena

SCOPe Domain Coordinates for d2bi5b_:

Click to download the PDB-style file with coordinates for d2bi5b_.
(The format of our PDB-style files is described here.)

Timeline for d2bi5b_: