Lineage for d2bi1b1 (2bi1 B:3-360)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705854Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 706023Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)
  7. 706024Species Bacillus alcalophilus [TaxId:1445] [117697] (10 PDB entries)
  8. 706034Domain d2bi1b1: 2bi1 B:3-360 [128568]
    automatically matched to 2BIE A:3-360
    complexed with 1pe, cl, mg, peg, plp

Details for d2bi1b1

PDB Entry: 2bi1 (more details), 1.69 Å

PDB Description: radiation damage of the schiff base in phosphoserine aminotransferase (structure b)
PDB Compounds: (B:) phosphoserine aminotransferase

SCOP Domain Sequences for d2bi1b1:

Sequence, based on SEQRES records: (download)

>d2bi1b1 c.67.1.4 (B:3-360) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]}
qvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrellq
ipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaast
kansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsrpl
kvnqfgmiyagaqknlgpsgvtvvivkkdllntkveqvptmlqyathiksdslyntpptf
siymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvtfn
lrneelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena

Sequence, based on observed residues (ATOM records): (download)

>d2bi1b1 c.67.1.4 (B:3-360) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]}
qvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrellq
ipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaast
kansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsrpl
kvnqfgmiyagaqknlgpsgvtvvivkkdllveqvptmlqyathiksdslyntpptfsiy
mlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvtfnlrn
eelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena

SCOP Domain Coordinates for d2bi1b1:

Click to download the PDB-style file with coordinates for d2bi1b1.
(The format of our PDB-style files is described here.)

Timeline for d2bi1b1: