Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.4: MaoC-like [82636] (6 proteins) |
Protein Hypothetical protein Rv0216/MT0226 [143169] (1 species) duplication: consists of two MaoC-like domains |
Species Mycobacterium tuberculosis [TaxId:1773] [143170] (1 PDB entry) Uniprot P96398 186-337! Uniprot P96398 8-185 |
Domain d2bi0a2: 2bi0 A:186-337 [128566] complexed with cl |
PDB Entry: 2bi0 (more details), 1.9 Å
SCOPe Domain Sequences for d2bi0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} ptahwdgavfrkrvpgphfdagiagavlhstadlvsgapelarltlniaathhdwrvsgr rlvygghtiglalaqatrllpnlatvldwescdhtapvhegdtlyselhiesaqahadgg vlglrslvyavsdsasepdrqvldwrfsalqf
Timeline for d2bi0a2: