SCOPe 2.05: Domain d2bi0a2: 2bi0 A:186-337

Lineage for d2bi0a2 (2bi0 A:186-337)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.4: MaoC-like [82636] (6 proteins)

6. Protein Hypothetical protein Rv0216/MT0226 [143169] (1 species)
   duplication: consists of two MaoC-like domains

7. Species Mycobacterium tuberculosis [TaxId:1773] [143170] (1 PDB entry)
   Uniprot P96398 186-337! Uniprot P96398 8-185

8. Domain d2bi0a2: 2bi0 A:186-337 [128566]
   complexed with cl

Details for d2bi0a2

PDB Entry: 2bi0, 1.9 Å

PDB Description: rv0216, a conserved hypothetical protein from mycobacterium tuberculosis that is essential for bacterial survival during infection, has a double hotdogfold

PDB Compounds: (A:) hypothetical protein rv0216

SCOPe Domain Sequences for d2bi0a2:

Sequence; same for both SEQRES and ATOM records:

>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]}
ptahwdgavfrkrvpgphfdagiagavlhstadlvsgapelarltlniaathhdwrvsgr
rlvygghtiglalaqatrllpnlatvldwescdhtapvhegdtlyselhiesaqahadgg
vlglrslvyavsdsasepdrqvldwrfsalqf

Timeline for d2bi0a2:

• d2bi0a2 first appeared in SCOP 1.73
  
• d2bi0a2 appears in SCOPe 2.04
  
• d2bi0a2 appears in SCOPe 2.06
  
• d2bi0a2 appears in the current release, SCOPe 2.08