Lineage for d2bi0a1 (2bi0 A:8-185)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2187946Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 2188005Protein Hypothetical protein Rv0216/MT0226 [143169] (1 species)
    duplication: consists of two MaoC-like domains
  7. 2188006Species Mycobacterium tuberculosis [TaxId:1773] [143170] (1 PDB entry)
    Uniprot P96398 186-337! Uniprot P96398 8-185
  8. 2188007Domain d2bi0a1: 2bi0 A:8-185 [128565]
    complexed with cl

Details for d2bi0a1

PDB Entry: 2bi0 (more details), 1.9 Å

PDB Description: rv0216, a conserved hypothetical protein from mycobacterium tuberculosis that is essential for bacterial survival during infection, has a double hotdogfold
PDB Compounds: (A:) hypothetical protein rv0216

SCOPe Domain Sequences for d2bi0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]}
irvggpyfddlskgqvfdwapgvtlslglaaahqsivgnrlrlaldsdlcaavtgmpgpl
ahpglvcdvaigqstlatqrvkanlfyrglrfhrfpavgdtlytrtevvglranspkpgr
aptglaglrmttidrtdrlvldfyrcamlpaspdwkpgavpgddlsrigadapapaad

SCOPe Domain Coordinates for d2bi0a1:

Click to download the PDB-style file with coordinates for d2bi0a1.
(The format of our PDB-style files is described here.)

Timeline for d2bi0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bi0a2