SCOP 1.75: Domain d2bhza3: 2bhz A:111-530

Lineage for d2bhza3 (2bhz A:111-530)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (25 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Glycosyltrehalose trehalohydrolase, central domain [51468] (2 species)
   contains an additional N-terminal domain

7. Species Deinococcus radiodurans [TaxId:1299] [141769] (9 PDB entries)
   Uniprot Q9RX51 111-528

8. Domain d2bhza3: 2bhz A:111-530 [128564]
   Other proteins in same PDB: d2bhza1, d2bhza2
   automatically matched to 2BHU A:111-530
   complexed with bme, mal, mg, trs; mutant

Details for d2bhza3

PDB Entry: 2bhz, 1.2 Å

PDB Description: crystal structure of deinococcus radiodurans maltooligosyltrehalose trehalohydrolase in complex with maltose

PDB Compounds: (A:) maltooligosyltrehalose trehalohydrolase

SCOP Domain Sequences for d2bhza3:

Sequence; same for both SEQRES and ATOM records:

>d2bhza3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]}
tfdwtdadwhgikladcvfyevhvgtftpegtyraaaeklpylkelgvtaiqvmplaafd
gqrgwgydgaafyapyapygrpedlmalvdaahrlglgvfldvvynhfgpsgnylssyap
syftdrfssawgmgldyaephmrryvtgnarmwlrdyhfdglrldatpymtddsethilt
elaqeihelggthlllaedhrnlpdlvtvnhldgiwtddfhhetrvtltgeqegyyagyr
ggaealaytirrgwryegqfwavkgeeherghpsdaleapnfvyciqnhdqignrplger
lhqsdgvtlheyrgaaallltlpmtpllfqgqewaastpfqffsdhagelgqavsegrkk
efggfsgfsgedvpdpqaeqtflnsklnwaereggehartlrlyrdllrlrredpvlhnr

Timeline for d2bhza3:

• d2bhza3 first appeared in SCOP 1.73
  
• d2bhza3 appears in SCOPe 2.01
  
• d2bhza3 appears in the current release, SCOPe 2.08