SCOPe 2.06: Domain d2bhza2: 2bhz A:531-602

Lineage for d2bhza2 (2bhz A:531-602)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Glycosyltrehalose trehalohydrolase [51034] (2 species)

7. Species Deinococcus radiodurans [TaxId:1299] [141553] (9 PDB entries)
   Uniprot Q9RX51 529-600

8. Domain d2bhza2: 2bhz A:531-602 [128563]
   Other proteins in same PDB: d2bhza1, d2bhza3
   automated match to d2bhua2
   complexed with bme, mal, mg, trs

Details for d2bhza2

PDB Entry: 2bhz, 1.2 Å

PDB Description: crystal structure of deinococcus radiodurans maltooligosyltrehalose trehalohydrolase in complex with maltose

PDB Compounds: (A:) maltooligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d2bhza2:

Sequence; same for both SEQRES and ATOM records:

>d2bhza2 b.71.1.1 (A:531-602) Glycosyltrehalose trehalohydrolase {Deinococcus radiodurans [TaxId: 1299]}
qrenlttghdgdvlwvrtvtgagervllwnlgqdtravaevklpftvprrlllhtegred
ltlgageavlvg

Timeline for d2bhza2:

• d2bhza2 first appeared in SCOP 1.73
  
• d2bhza2 appears in SCOPe 2.05
  
• d2bhza2 appears in SCOPe 2.07
  
• d2bhza2 appears in the current release, SCOPe 2.08