![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species) domain architecture similar to isoamylase |
![]() | Species Deinococcus radiodurans [TaxId:1299] [141019] (9 PDB entries) Uniprot Q9RX51 14-110 |
![]() | Domain d2bhya1: 2bhy A:14-110 [128559] Other proteins in same PDB: d2bhya2, d2bhya3 automated match to d2bhua1 complexed with bme, glc, mg, tre, trs |
PDB Entry: 2bhy (more details), 1.5 Å
SCOPe Domain Sequences for d2bhya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bhya1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]} sfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmtslgggiyelelpv gpgarylfvldgvptpdpyarflpdgvhgeaevvdfg
Timeline for d2bhya1: